PDB entry 6a2s

View 6a2s on RCSB PDB site
Description: Mycobacterium tuberculosis LexA C-domain S160A
Class: hydrolase
Keywords: Mycobacterium tuberculosis, LexA, SOS response, HYDROLASE
Deposited on 2018-06-12, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lexa repressor
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: lexA, Rv2720, MTCY05A6.41
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WHR7 (Start-110)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d6a2sa_
  • Chain 'B':
    Compound: lexa repressor
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: lexA, Rv2720, MTCY05A6.41
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WHR7 (Start-110)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d6a2sb_
  • Chain 'C':
    Compound: lexa repressor
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: lexA, Rv2720, MTCY05A6.41
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WHR7 (Start-110)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d6a2sc_
  • Chain 'D':
    Compound: lexa repressor
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: lexA, Rv2720, MTCY05A6.41
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WHR7 (Start-110)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d6a2sd_
  • Chain 'E':
    Compound: lexa repressor
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: lexA, Rv2720, MTCY05A6.41
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WHR7 (Start-110)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d6a2se_
  • Chain 'F':
    Compound: lexa repressor
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: lexA, Rv2720, MTCY05A6.41
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WHR7 (Start-110)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d6a2sf_
  • Chain 'G':
    Compound: lexa repressor
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: lexA, Rv2720, MTCY05A6.41
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WHR7 (Start-110)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d6a2sg_
  • Chain 'H':
    Compound: lexa repressor
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: lexA, Rv2720, MTCY05A6.41
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WHR7 (Start-110)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d6a2sh_
  • Heterogens: PEG, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a2sA (A:)
    ggpilaeeavedvfplprelvgegtlfllkvigdamveaaicdgdwvvvrqqnvadngdi
    vaamidgeatvktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a2sA (A:)
    dvfplprelvgegtlfllkvigdamveaaicdgdwvvvrqqnvadngdivaamidgeatv
    ktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a2sB (B:)
    ggpilaeeavedvfplprelvgegtlfllkvigdamveaaicdgdwvvvrqqnvadngdi
    vaamidgeatvktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a2sB (B:)
    dvfplprelvgegtlfllkvigdamveaaicdgdwvvvrqqnvadngdivaamidgeatv
    ktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6a2sC (C:)
    ggpilaeeavedvfplprelvgegtlfllkvigdamveaaicdgdwvvvrqqnvadngdi
    vaamidgeatvktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a2sC (C:)
    dvfplprelvgegtlfllkvigdamveaaicdgdwvvvrqqnvadngdivaamidgeatv
    ktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6a2sD (D:)
    ggpilaeeavedvfplprelvgegtlfllkvigdamveaaicdgdwvvvrqqnvadngdi
    vaamidgeatvktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a2sD (D:)
    dvfplprelvgegtlfllkvigdamveaaicdgdwvvvrqqnvadngdivaamidgeatv
    ktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6a2sE (E:)
    ggpilaeeavedvfplprelvgegtlfllkvigdamveaaicdgdwvvvrqqnvadngdi
    vaamidgeatvktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a2sE (E:)
    dvfplprelvgegtlfllkvigdamveaaicdgdwvvvrqqnvadngdivaamidgeatv
    ktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6a2sF (F:)
    ggpilaeeavedvfplprelvgegtlfllkvigdamveaaicdgdwvvvrqqnvadngdi
    vaamidgeatvktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a2sF (F:)
    dvfplprelvgegtlfllkvigdamveaaicdgdwvvvrqqnvadngdivaamidgeatv
    ktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6a2sG (G:)
    ggpilaeeavedvfplprelvgegtlfllkvigdamveaaicdgdwvvvrqqnvadngdi
    vaamidgeatvktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a2sG (G:)
    dvfplprelvgegtlfllkvigdamveaaicdgdwvvvrqqnvadngdivaamidgeatv
    ktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6a2sH (H:)
    ggpilaeeavedvfplprelvgegtlfllkvigdamveaaicdgdwvvvrqqnvadngdi
    vaamidgeatvktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a2sH (H:)
    dvfplprelvgegtlfllkvigdamveaaicdgdwvvvrqqnvadngdivaamidgeatv
    ktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv