PDB entry 6a2r

View 6a2r on RCSB PDB site
Description: Mycobacterium tuberculosis LexA C-domain II
Class: hydrolase
Keywords: Mycobacterium tuberculosis, LexA, SOS response, HYDROLASE
Deposited on 2018-06-12, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lexa repressor
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: lexA, Rv2720, MTCY05A6.41
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a2ra_
  • Chain 'B':
    Compound: lexa repressor
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: lexA, Rv2720, MTCY05A6.41
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a2rb_
  • Chain 'C':
    Compound: lexa repressor
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: lexA, Rv2720, MTCY05A6.41
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a2rc_
  • Chain 'D':
    Compound: lexa repressor
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: lexA, Rv2720, MTCY05A6.41
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a2rd_
  • Chain 'E':
    Compound: lexa repressor
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: lexA, Rv2720, MTCY05A6.41
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a2re_
  • Chain 'F':
    Compound: lexa repressor
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: lexA, Rv2720, MTCY05A6.41
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a2rf_
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a2rA (A:)
    ggpilaeeavedvfplprelvgegtlfllkvigdsmveaaicdgdwvvvrqqnvadngdi
    vaamidgeatvktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a2rA (A:)
    vfplprelvgegtlfllkvigdsmveaaicdgdwvvvrqqnvadngdivaamidgeatvk
    tfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a2rB (B:)
    ggpilaeeavedvfplprelvgegtlfllkvigdsmveaaicdgdwvvvrqqnvadngdi
    vaamidgeatvktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a2rB (B:)
    vfplprelvgegtlfllkvigdsmveaaicdgdwvvvrqqnvadngdivaamidgeatvk
    tfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6a2rC (C:)
    ggpilaeeavedvfplprelvgegtlfllkvigdsmveaaicdgdwvvvrqqnvadngdi
    vaamidgeatvktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a2rC (C:)
    vfplprelvgegtlfllkvigdsmveaaicdgdwvvvrqqnvadngdivaamidgeatvk
    tfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6a2rD (D:)
    ggpilaeeavedvfplprelvgegtlfllkvigdsmveaaicdgdwvvvrqqnvadngdi
    vaamidgeatvktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a2rD (D:)
    vfplprelvgegtlfllkvigdsmveaaicdgdwvvvrqqnvadngdivaamidgeatvk
    tfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6a2rE (E:)
    ggpilaeeavedvfplprelvgegtlfllkvigdsmveaaicdgdwvvvrqqnvadngdi
    vaamidgeatvktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a2rE (E:)
    vfplprelvgegtlfllkvigdsmveaaicdgdwvvvrqqnvadngdivaamidgeatvk
    tfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6a2rF (F:)
    ggpilaeeavedvfplprelvgegtlfllkvigdsmveaaicdgdwvvvrqqnvadngdi
    vaamidgeatvktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a2rF (F:)
    vfplprelvgegtlfllkvigdsmveaaicdgdwvvvrqqnvadngdivaamidgeatvk
    tfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv