PDB entry 6a2q

View 6a2q on RCSB PDB site
Description: Mycobacterium tuberculosis LexA C-domain I
Class: hydrolase
Keywords: Mycobacterium tuberculosis, LexA, SOS response, HYDROLASE
Deposited on 2018-06-12, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lexa repressor
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: lexA, Rv2720, MTCY05A6.41
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a2qa_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a2qA (A:)
    hhhhhhmggpilaeeavedvfplprelvgegtlfllkvigdsmveaaicdgdwvvvrqqn
    vadngdivaamidgeatvktfkraggqvwlmphnpafdpipgndatvlgkvvtvirkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a2qA (A:)
    fplprelvgegtlfllkvigdsmveaaicdgdwvvvrqqnvadngdivaamidgeatvkt
    fkraggqvwlmphnpafdpipgndatvlgkvvtvirkv