PDB entry 6a2d

View 6a2d on RCSB PDB site
Description: Crystal structure of a synthase 2 from santalum album in complex with ligand1
Class: oxidoreductase
Keywords: substrate binding, synthase, inhibitor, OXIDOREDUCTASE
Deposited on 2018-06-10, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sesquisabinene B synthase 2
    Species: Santalum album [TaxId:35974]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a2da1, d6a2da2
  • Chain 'B':
    Compound: Sesquisabinene B synthase 2
    Species: Santalum album [TaxId:35974]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a2db1, d6a2db2
  • Heterogens: 6R2, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a2dA (A:)
    masvivepircnndndvistvvddssvvrraanyppnlwdyeflqslgdqctveekhlkl
    adklkeevkslikqtmepltklefidtvrrlglkyqfetevkeavvmvskyendawwidn
    lhatslrfrimrengifvpqdvferfkdtdgfknqlcedvkgllslyeasflgwegedil
    deartfatsklksiegkipspslakkvshaldlplhwrtiryearwfidtyeeeedvnlt
    llryakldfnivqsfhqkeigrlsrwwvgtgldkmpfarngliqsymyaigmlfepnlge
    vremeakvgalittiddvydvygtmeelelftditnrwdiskadqlprnirmplltmfnt
    sndigywalkergfngipctakvwsdqlksytkeakwfheghkptleeyldnalvsigfp
    nllvtsylltvenptkekldyvnslplfvrascilcriindlgtspdemergdnlksiqc
    ymneagasqevarehieglvrmwwkrlnkclfepspfaepflsftvnvvrgshffyqygd
    gygnaeswtkkqgmsvlihpiplnee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a2dA (A:)
    anyppnlwdyeflqslgdkhlkladklkeevkslikqtmepltklefidtvrrlglkyqf
    etevkeavvmvskyendawwidnlhatslrfrimrengifvpqdvferfkdtdgfknqlc
    edvkgllslyeasflgwegedildeartfatsklksiegkipspslakkvshaldlplhw
    rtiryearwfidtyeeeedvnltllryakldfnivqsfhqkeigrlsrwwvgtgldkmpf
    arngliqsymyaigmlfepnlgevremeakvgalittiddvydvygtmeelelftditnr
    wdiskadqlprnirmplltmfntsndigywalkergfngipctakvwsdqlksytkeakw
    fheghkptleeyldnalvsigfpnllvtsylltvenptkekldyvnslplfvrascilcr
    iindlgtsplksiqcymneagasqevarehieglvrmwwkrlnkclfepspfaepflsft
    vnvvrgshffyqynaeswtkkqgmsvlihpiplne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a2dB (B:)
    masvivepircnndndvistvvddssvvrraanyppnlwdyeflqslgdqctveekhlkl
    adklkeevkslikqtmepltklefidtvrrlglkyqfetevkeavvmvskyendawwidn
    lhatslrfrimrengifvpqdvferfkdtdgfknqlcedvkgllslyeasflgwegedil
    deartfatsklksiegkipspslakkvshaldlplhwrtiryearwfidtyeeeedvnlt
    llryakldfnivqsfhqkeigrlsrwwvgtgldkmpfarngliqsymyaigmlfepnlge
    vremeakvgalittiddvydvygtmeelelftditnrwdiskadqlprnirmplltmfnt
    sndigywalkergfngipctakvwsdqlksytkeakwfheghkptleeyldnalvsigfp
    nllvtsylltvenptkekldyvnslplfvrascilcriindlgtspdemergdnlksiqc
    ymneagasqevarehieglvrmwwkrlnkclfepspfaepflsftvnvvrgshffyqygd
    gygnaeswtkkqgmsvlihpiplnee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a2dB (B:)
    yppnlwdyeflqslgdqctveekhlkladklkeevkslikqtmepltklefidtvrrlgl
    kyqfetevkeavvmvskyendawwidnlhatslrfrimrengifvpqdvferfkdtdgfk
    nqlcedvkgllslyeasflgwegedildeartfatsklksiegkipspslakkvshaldl
    plhwrtiryearwfidtyeeeedvnltllryakldfnivqsfhqkeigrlsrwwvgtgld
    kmpfarngliqsymyaigmlfepnlgevremeakvgalittiddvydvygtmeelelftd
    itnrwdiskadqlprnirmplltmfntsndigywalkergfngipctakvwsdqlksytk
    eakwfheghkptleeyldnalvsigfpnllvtsylltvenptkekldyvnslplfvrasc
    ilcriindlgtlksiqcymneasqevarehieglvrmwwkrlnkclfepspfaepflsft
    vnvvrgshffyqygdgygnaeswtkkqgmsvlihpipln