PDB entry 6a2b

View 6a2b on RCSB PDB site
Description: Crystal Structure of Xenopus laevis MHC I complex
Class: immune system
Keywords: Xenopus laevis, MHC I, evolution, immune system
Deposited on 2018-06-10, released 2019-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I antigen
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a2ba1, d6a2ba2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Xenopus laevis [TaxId:8355]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a2bb_
  • Chain 'C':
    Compound: tyr-met-met-pro-arg-his-trp-pro-ile
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A2B (0-8)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a2bA (A:)
    gshslryyytavsdrafglpefsivgyvddtqsfrynsdnqkaepatqwmkqkegpeywe
    qqtqiakgsepvhkhdvktamdrfnqtsgthslqvmygcelrednsirsyhqygydgref
    ialdterwvyvpsvreaqlteqkwnspevnapernknylqnlcieglkrylsygraeler
    rvhphvrisdhqsddatelrchaygfypreidvkwvkngradvhseaakeilpnpdgsyq
    lrvtaeitpsegdsyachvehsslkeklivvw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a2bB (B:)
    isppvvkvytaepvdfgktnevicyvynyhpprlemrlekngveipdckqtdpsfqhnwk
    yyttksthvhidkgdkvecvvshngnpskkyrld
    

  • Chain 'C':
    No sequence available.