PDB entry 6a23

View 6a23 on RCSB PDB site
Description: Mandelate oxidase mutant-Y128F with the N5-benzyl-FMN adduct
Class: flavoprotein
Keywords: FMN-dependent oxidase, FLAVOPROTEIN
Deposited on 2018-06-08, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxymandelate oxidase
    Species: Amycolatopsis orientalis [TaxId:31958]
    Gene: hmo
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52792 (Start-376)
      • engineered mutation (147)
    Domains in SCOPe 2.07: d6a23a_
  • Heterogens: 9OU, MG, 173, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a23A (A:)
    mgsshhhhhhssglvprgshmtyvsladleraardvlpgeifdflaggsgteaslvanrt
    alervfviprmlrdltdvtteidifgrraalpmavapvayqrlfhpegelavaraardag
    vpytictlssvsleeiaavggrpwfqlfwlrdekrsldlvrraedagceaivftvdvpwm
    grrlrdmrngfalpewvtaanfdagtaahrrtqgvsavadhtarefapatwesveavrah
    tdlpvvlkgilavedarravdagaggivvsnhggrqldgavpgiemlgeivaavsggcev
    lvdggirsggdvlkatalgasavlvgrpvmwalaaagqdgvrqllellaeevrdamglag
    cesvgaarrlntklgvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a23A (A:)
    yvsladleraardvlpgeifdflaggsgteaslvanrtalervfviprmlrdltdvttei
    difgrraalpmavapvayqrlfhpegelavaraardagvpytictlssvsleeiaavggr
    pwfqlfwlrdekrsldlvrraedagceaivftvdvpwmgrrlrdmrngfalpewvtaanf
    dfapatwesveavrahtdlpvvlkgilavedarravdagaggivvsnhggrqldgavpgi
    emlgeivaavsggcevlvdggirsggdvlkatalgasavlvgrpvmwalaaagqdgvrql
    lellaeevrdamglagcesvgaarrlntklgvv