PDB entry 6a1s

View 6a1s on RCSB PDB site
Description: Charcot-Leyden crystal protein/Galectin-10 variant E33A
Class: protein binding
Keywords: Charcot-Leyden crystal protein/Galectin-10, PROTEIN BINDING
Deposited on 2018-06-08, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-10
    Species: Homo sapiens [TaxId:9606]
    Gene: CLC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05315 (Start-144)
      • engineered mutation (35)
    Domains in SCOPe 2.07: d6a1sa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a1sA (A:)
    gshmsllpvpyteaaslstgstvtikgrplacflnapylqvdfhtemkeesdivfhfqvc
    fgrrvvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrik
    peavkmvqvwrdisltkfnvsylkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a1sA (A:)
    sllpvpyteaaslstgstvtikgrplacflnapylqvdfhtemkeesdivfhfqvcfgrr
    vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
    kmvqvwrdisltkfnvsylkr