PDB entry 6a1k

View 6a1k on RCSB PDB site
Description: Phosphate acyltransferase PlsX from B.subtilis
Class: transferase
Keywords: Phosphate acyltransferase, TRANSFERASE
Deposited on 2018-06-07, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphate acyltransferase
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Gene: plsX, ylpD, BSU15890
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a1ka_
  • Chain 'B':
    Compound: Phosphate acyltransferase
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Gene: plsX, ylpD, BSU15890
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a1kb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a1kA (A:)
    mriavdamggdhapkavidgvikgieafddlhitlvgdkttieshltttsdritvlhade
    vieptdepvravrrkknssmvlmaqevaenradacisagntgalmtaglfivgrikgidr
    palaptlptvsgdgfllldvganvdakpehlvqyaimgsvysqqvrgvtsprvgllnvgt
    edkkgneltkqtfqilketaninfignveardllddvadvvvtdgftgnvtlktlegsal
    sifkmmrdvmtstltsklaaavlkpklkemkmkmeysnyggaslfglkapvikahgssds
    navfhairqaremvsqnvaaliqeevlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a1kA (A:)
    mriavdamggdhapkavidgvikgieafddlhitlvgdkttieshltttsdritvlhade
    vieptdepvravrrkknssmvlmaqevaenradacisagntgalmtaglfivgrikgidr
    palaptlptvsgdgfllldvganvdakpehlvqyaimgsvysqqvrgvtsprvgllnvgt
    edkkgneltkqtfqilketaninfignveardllddvadvvvtdgftgnvtlktlegsal
    sifkmmrdvmtstltsklaaavlkpklkemkmkmeysnyggaslfglkapvikahgssds
    navfhairqaremvsqnvaaliqeev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a1kB (B:)
    mriavdamggdhapkavidgvikgieafddlhitlvgdkttieshltttsdritvlhade
    vieptdepvravrrkknssmvlmaqevaenradacisagntgalmtaglfivgrikgidr
    palaptlptvsgdgfllldvganvdakpehlvqyaimgsvysqqvrgvtsprvgllnvgt
    edkkgneltkqtfqilketaninfignveardllddvadvvvtdgftgnvtlktlegsal
    sifkmmrdvmtstltsklaaavlkpklkemkmkmeysnyggaslfglkapvikahgssds
    navfhairqaremvsqnvaaliqeevlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a1kB (B:)
    mriavdamggdhapkavidgvikgieafddlhitlvgdkttieshltttsdritvlhade
    vieptdepvravrrkknssmvlmaqevaenradacisagntgalmtaglfivgrikgidr
    palaptlptvsgdgfllldvganvdakpehlvqyaimgsvysqqvrgvtsprvgllnvgt
    edkkgneltkqtfqilketaninfignveardllddvadvvvtdgftgnvtlktlegsal
    sifkmmrdvmtstltsklaaavlkpklkemkmkmeysnyggaslfglkapvikahgssds
    navfhairqaremvsqnvaaliqee