PDB entry 6a1c

View 6a1c on RCSB PDB site
Description: Crystal structure of the CK2a1-go289 complex
Class: transferase
Keywords: CK2a1, Inhibitor, Complex, TRANSFERASE
Deposited on 2018-06-07, released 2019-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK2A1, CK2A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a1ca_
  • Heterogens: 9NX, NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a1cA (A:)
    gplgsmsgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfe
    ainitnnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfeh
    vnntdfkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlid
    wglaefyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhg
    hdnydqlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvsp
    ealdfldkllrydhqsrltareamehpyfytvvkdqarmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a1cA (A:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
    nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
    kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
    yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
    lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
    dkllrydhqsrltareamehpyfytvvkdqarmg