PDB entry 6a17

View 6a17 on RCSB PDB site
Description: Crystal structure of CYP90B1 in complex with brassinazole
Class: oxidoreductase
Keywords: cytochrome P450, phytohormone, brassinosteroid, brassinazole, OXIDOREDUCTASE
Deposited on 2018-06-06, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 90B1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CYP90B1, DWF4, At3g50660, T3A5.40
    Database cross-references and differences (RAF-indexed):
    • Uniprot O64989 (Start-452)
      • engineered mutation (445)
    Domains in SCOPe 2.07: d6a17a_
  • Heterogens: 9RL, HEM, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a17A (A:)
    makrrnrktrfnlppgksgwpflgetigylkpytattlgdfmqqhvskygkiyrsnlfge
    ptivsadaglnrfilqnegrlfecsyprsiggilgkwsmlvlvgdmhrdmrsislnflsh
    arlrtillkdverhtlfvldswqqnsifsaqdeakkftfnlmakhimsmdpgeeeteqlk
    keyvtfmkgvvsaplnlpgtayhkalqsratilkfierkmeerkldikerkqrtdddllg
    wvlkhsnlsteqildlilsllfaghetssvaialaifflqacpkaveelreehleiarak
    kelgeselnwddykkmdftqcvinetlrlgnvvrflhrkalkdvrykgydipsgwkvlpv
    isavhldnsrydqpnlfnpwrwqqqntwgnnympfgggprlcagselaklemavfihhlv
    lkfnwelaeddkpfafpfvdfpngllirvsrilhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a17A (A:)
    rfnlppgksgwpflgetigylkpytattlgdfmqqhvskygkiyrsnlfgeptivsadag
    lnrfilqnegrlfecsyprsiggilgkwsmlvlvgdmhrdmrsislnflsharlrtillk
    dverhtlfvldswqqnsifsaqdeakkftfnlmakhimsmdpgeeeteqlkkeyvtfmkg
    vvsaplnlpgtayhkalqsratilkfierkmeerkldikerkqrtdddllgwvlkhsnls
    teqildlilsllfaghetssvaialaifflqacpkaveelreehleiarakkelgeseln
    wddykkmdftqcvinetlrlgnvvrflhrkalkdvrykgydipsgwkvlpvisavhldns
    rydqpnlfnpwrwqqqntwgnnympfgggprlcagselaklemavfihhlvlkfnwelae
    ddkpfafpfvdfpngllirvsril