PDB entry 6a15

View 6a15 on RCSB PDB site
Description: Structure of CYP90B1 in complex with cholesterol
Class: oxidoreductase
Keywords: cytochrome P450, phytohormone, brassinosteroid, cholesterol, OXIDOREDUCTASE
Deposited on 2018-06-06, released 2019-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 1.7900000000000003 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 90B1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CYP90B1, DWF4, At3g50660, T3A5.40
    Database cross-references and differences (RAF-indexed):
    • Uniprot O64989 (Start-451)
      • engineered mutation (444)
      • expression tag (452-454)
    Domains in SCOPe 2.08: d6a15a1, d6a15a2
  • Heterogens: HEM, CLR, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a15A (A:)
    makrrnrktrfnlppgksgwpflgetigylkpytattlgdfmqqhvskygkiyrsnlfge
    ptivsadaglnrfilqnegrlfecsyprsiggilgkwsmlvlvgdmhrdmrsislnflsh
    arlrtillkdverhtlfvldswqqnsifsaqdeakkftfnlmakhimsmdpgeeeteqlk
    keyvtfmkgvvsaplnlpgtayhkalqsratilkfierkmeerkldikerkqrtdddllg
    wvlkhsnlsteqildlilsllfaghetssvaialaifflqacpkaveelreehleiarak
    kelgeselnwddykkmdftqcvinetlrlgnvvrflhrkalkdvrykgydipsgwkvlpv
    isavhldnsrydqpnlfnpwrwqqqtwgnnympfgggprlcagselaklemavfihhlvl
    kfnwelaeddkpfafpfvdfpngllirvsrilhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a15A (A:)
    trfnlppgksglgetigylkpytattlgdfmqqhvskygkiyrsnlfgeptivsadagln
    rfilqnegrlfecsyprsiggilgkwsmlvlvgdmhrdmrsislnflsharlrtillkdv
    erhtlfvldswqqnsifsaqdeakkftfnlmakhimsmdpgeeeteqlkkeyvtfmkgvv
    saplnlpgtayhkalqsratilkfierkmeerkldikerktdddllgwvlkhsnlsteqi
    ldlilsllfaghetssvaialaifflqacpkaveelreehleiarakkelgeselnwddy
    kkmdftqcvinetlrlgnvvrflhrkalkdvrykgydipsgwkvlpvisavhldnsrydq
    pnlfnpwrwqqqnnympfgggprlcagselaklemavfihhlvlkfnwelaeddkpfafp
    fvdfpngllirvsrilhhh