PDB entry 6a12

View 6a12 on RCSB PDB site
Description: X-ray structure of lipase from Geobacillus thermoleovorans
Class: hydrolase
Keywords: Lipase, Geobacillus thermoleovorans, Hydrolase
Deposited on 2018-06-06, released 2018-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipase
    Species: Geobacillus thermoleovorans [TaxId:33941]
    Gene: LIPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8L1V2 (Start-388)
      • see sequence details (386-387)
    Domains in SCOPe 2.08: d6a12a_
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a12A (A:)
    matsrandapivllhgftgwgreemfgfkywggvrgdieqwlndngyrtytlavgplssn
    wdraceayaqlvggtvdygaahaakhgharfgrtypgllpelkrggrihiiahsqggqta
    rmlvsllengsqeereyakahnvslsplfegghhfvlsvttiatphdgttlvnmvdftdr
    ffdlqkavleaaavasnapytseiydfkldqwglrrepgesfdhyferlkrspvwtstdt
    arydlsvpgaetlnrwvkaspntyylsfstertyrgaltgnyypelgmnafsaivcapfl
    gsyrnaalgidshwlendgivntismngpkrgssdrivpydgalkkgvwndmgtynvdhl
    eiigvdpnpsfdirafylrlaeqlaslrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a12A (A:)
    srandapivllhgftgwgreemfgfkywggvrgdieqwlndngyrtytlavgplssnwdr
    aceayaqlvggtvdygaahaakhgharfgrtypgllpelkrggrihiiahsqggqtarml
    vsllengsqeereyakahnvslsplfegghhfvlsvttiatphdgttlvnmvdftdrffd
    lqkavleaaavasnapytseiydfkldqwglrrepgesfdhyferlkrspvwtstdtary
    dlsvpgaetlnrwvkaspntyylsfstertyrgaltgnyypelgmnafsaivcapflgsy
    rnaalgidshwlendgivntismngpkrgssdrivpydgalkkgvwndmgtynvdhleii
    gvdpnpsfdirafylrlaeqlaslrp