PDB entry 6a0z

View 6a0z on RCSB PDB site
Description: Crystal structure of broadly neutralizing antibody 13D4 bound to H5N1 influenza hemagglutinin, HA head region
Class: viral protein/immune system
Keywords: Immune complex, Antibody, VIRAL PROTEIN, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2018-06-06, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin,Envelope glycoprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Antibody 13D4, Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A0Z (0-223)
  • Chain 'L':
    Compound: Antibody 13D4, Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A0Z (0-End)
    Domains in SCOPe 2.07: d6a0zl1, d6a0zl2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6a0zL (L:)
    divmtqsqkfmsasvgdrvsvtckasqnvgthlawyqqkpgqspkaliysasyrysgvpd
    rftgsgsgtdftltisnvqsgdladyfcqqynnfpltfgagtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltrdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a0zL (L:)
    divmtqsqkfmsasvgdrvsvtckasqnvgthlawyqqkpgqspkaliysasyrysgvpd
    rftgsgsgtdftltisnvqsgdladyfcqqynnfpltfgagtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltrdeyerhnsytceathktstspivksfnrn