PDB entry 6a0x

View 6a0x on RCSB PDB site
Description: Crystal structure of broadly neutralizing antibody 13D4
Class: immune system
Keywords: Antibody, IMMUNE SYSTEM
Deposited on 2018-06-06, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antibody 13D4, Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A0X (0-223)
  • Chain 'B':
    Compound: Antibody 13D4, Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A0X (0-213)
    Domains in SCOPe 2.07: d6a0xb1, d6a0xb2
  • Chain 'C':
    Compound: Antibody 13D4, Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A0X (0-223)
  • Chain 'D':
    Compound: Antibody 13D4, Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A0X (0-213)
    Domains in SCOPe 2.07: d6a0xd1, d6a0xd2
  • Chain 'E':
    Compound: Antibody 13D4, Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A0X (0-223)
  • Chain 'F':
    Compound: Antibody 13D4, Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A0X (0-213)
    Domains in SCOPe 2.07: d6a0xf1, d6a0xf2
  • Chain 'G':
    Compound: Antibody 13D4, Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A0X (0-223)
  • Chain 'H':
    Compound: Antibody 13D4, Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A0X (0-213)
    Domains in SCOPe 2.07: d6a0xh1, d6a0xh2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a0xB (B:)
    divmtqsqkfmsasvgdrvsvtckasqnvgthlawyqqkpgqspkaliysasyrysgvpd
    rftgsgsgtdftltisnvqsgdladyfcqqynnfpltfgagtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltrdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a0xD (D:)
    divmtqsqkfmsasvgdrvsvtckasqnvgthlawyqqkpgqspkaliysasyrysgvpd
    rftgsgsgtdftltisnvqsgdladyfcqqynnfpltfgagtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltrdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a0xF (F:)
    divmtqsqkfmsasvgdrvsvtckasqnvgthlawyqqkpgqspkaliysasyrysgvpd
    rftgsgsgtdftltisnvqsgdladyfcqqynnfpltfgagtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltrdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a0xH (H:)
    divmtqsqkfmsasvgdrvsvtckasqnvgthlawyqqkpgqspkaliysasyrysgvpd
    rftgsgsgtdftltisnvqsgdladyfcqqynnfpltfgagtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltrdeyerhnsytceathktstspivksfnrnec