PDB entry 6a04

View 6a04 on RCSB PDB site
Description: Structure of pSTING complex
Class: signaling protein
Keywords: pSTING, SIGNALING PROTEIN
Deposited on 2018-06-05, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stimulator of interferon genes protein
    Species: Sus scrofa [TaxId:9823]
    Gene: Tmem173, Sting
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8XX90 (2-End)
      • expression tag (1)
      • conflict (110)
    Domains in SCOPe 2.07: d6a04a1, d6a04a2
  • Chain 'B':
    Compound: Stimulator of interferon genes protein
    Species: Sus scrofa [TaxId:9823]
    Gene: Tmem173, Sting
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8XX90 (2-End)
      • expression tag (1)
      • conflict (110)
    Domains in SCOPe 2.07: d6a04b1, d6a04b2
  • Heterogens: SO4, C2E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a04A (A:)
    aanfnvahglawsyyigylrlilpglrariqaynqrhknvlggignhrlhilfpldcgvp
    ddlsvadpnirflhelpqqsadragikgrvytnsiyellengqpagvcvleyatplqtlf
    amsqdgragfsredrleqaklfcrtlediladapeaqnncrlivyqepteggsfslsqei
    lrhlrqeerevtmlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a04A (A:)
    anfnvahglawsyyigylrlilpglrariqaynqrhknvlggignhrlhilfpldcgvpd
    dlsvadpnirflhelpqqsadragikgrvytnsiyellengqpagvcvleyatplqtlfa
    msqdgragfsredrleqaklfcrtlediladapeaqnncrlivyqepteggsfslsqeil
    rhlrqee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6a04B (B:)
    aanfnvahglawsyyigylrlilpglrariqaynqrhknvlggignhrlhilfpldcgvp
    ddlsvadpnirflhelpqqsadragikgrvytnsiyellengqpagvcvleyatplqtlf
    amsqdgragfsredrleqaklfcrtlediladapeaqnncrlivyqepteggsfslsqei
    lrhlrqeerevtmlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a04B (B:)
    anfnvahglawsyyigylrlilpglrariqaynqrhknvlggignhrlhilfpldcgvpd
    dlsvadpnirflhelpqqgrvytnsiyellengqpagvcvleyatplqtlfamsqdgrag
    fsredrleqaklfcrtlediladapeaqnncrlivyqepteggsfslsqeilrhlrqeer
    ev