PDB entry 5zzj

View 5zzj on RCSB PDB site
Description: Crystal structure of a enzyme from Santalum album
Class: lyase
Keywords: substrate binding, synthase, inhibitor, LYASE
Deposited on 2018-06-01, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Santalene synthase
    Species: Santalum album [TaxId:35974]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zzja1, d5zzja2
  • Chain 'B':
    Compound: Santalene synthase
    Species: Santalum album [TaxId:35974]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zzjb1, d5zzjb2
  • Chain 'C':
    Compound: Santalene synthase
    Species: Santalum album [TaxId:35974]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zzjc1, d5zzjc2
  • Chain 'D':
    Compound: Santalene synthase
    Species: Santalum album [TaxId:35974]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zzjd1, d5zzjd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zzjA (A:)
    mdsstatamtapfidptdhvnlktdtdasenrrmgnykpsiwnydflqslathhniveer
    hlklaeklkgqvkfmfgapmeplaklelvdvvqrlglnhlfeteikealfsiykdgsngw
    wfghlhatslrfrllrqcglfipqdvfktfqnktgefdmklcdnvkgllslyeasylgwk
    genildeakafttkclksawenisekwlakrvkhalalplhwrvpriearwfieayeqea
    nmnptllklakldfnmvqsihqkeigelarwwvttgldklafarnnllqsymwscaiasd
    pkfklaretiveigsvltvvddgydvygsideldlytssverwscveidklpntlklifm
    smfnktnevglrvqhergynsiptfikawveqcksyqkearwfhgghtppleeyslnglv
    sigfplllitgyvaiaeneaaldkvhplpdllhyssllsrlindigtspdemargdnlks
    ihcymnetgaseevarehikgvieenwkilnqccfdqsqfqepfitfnlnsvrgshffye
    fgdgfgvtdswtkvdmksvlidpiplgee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zzjA (A:)
    psiwnydflqslathhniveerhlklaeklkgqvkfmfgapmeplaklelvdvvqrlgln
    hlfeteikealfsiykdgsngwwfghlhatslrfrllrqcglfipqdvfktfqnktgefd
    mklcdnvkgllslyeasylgwkgenildeakafttkclksawenisekwlakrvkhalal
    plhwrvpriearwfieayeqeanmnptllklakldfnmvqsihqkeigelarwwvttgld
    klafarnnllqsymwscaiasdpkfklaretiveigsvltvvddgydvygsideldlyts
    sverwscveidklpntlklifmsmfnktnevglrvqhergynsiptfikawveqcksyqk
    earwfhgghtppleeyslnglvsigfplllitgyvaiaeneaaldkvhplpdllhyssll
    srlindigtsdnlksihcymnetgaseevarehikgvieenwkilnqccfdqsqfqepfi
    tfnlnsvrgshffyefgdgfgvtdswtkvdmksvlidpiplg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zzjB (B:)
    mdsstatamtapfidptdhvnlktdtdasenrrmgnykpsiwnydflqslathhniveer
    hlklaeklkgqvkfmfgapmeplaklelvdvvqrlglnhlfeteikealfsiykdgsngw
    wfghlhatslrfrllrqcglfipqdvfktfqnktgefdmklcdnvkgllslyeasylgwk
    genildeakafttkclksawenisekwlakrvkhalalplhwrvpriearwfieayeqea
    nmnptllklakldfnmvqsihqkeigelarwwvttgldklafarnnllqsymwscaiasd
    pkfklaretiveigsvltvvddgydvygsideldlytssverwscveidklpntlklifm
    smfnktnevglrvqhergynsiptfikawveqcksyqkearwfhgghtppleeyslnglv
    sigfplllitgyvaiaeneaaldkvhplpdllhyssllsrlindigtspdemargdnlks
    ihcymnetgaseevarehikgvieenwkilnqccfdqsqfqepfitfnlnsvrgshffye
    fgdgfgvtdswtkvdmksvlidpiplgee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zzjB (B:)
    psiwnydflqslathhniveerhlklaeklkgqvkfmfgapmeplaklelvdvvqrlgln
    hlfeteikealfsiykdgsngwwfghlhatslrfrllrqcglfipqdvfktfqnktgefd
    mklcdnvkgllslyeasylgwkgenildeakafttkclksawenisekwlakrvkhalal
    plhwrvpriearwfieayeqeanmnptllklakldfnmvqsihqkeigelarwwvttgld
    klafarnnllqsymwscaiasdpkfklaretiveigsvltvvddgydvygsideldlyts
    sverwscveidklpntlklifmsmfnktnevglrvqhergynsiptfikawveqcksyqk
    earwfhgghtppleeyslnglvsigfplllitgyvaiaeneaaldkvhplpdllhyssll
    srlindigtslksihcymnetgaseevarehikgvieenwkilnqccfdqsqfqepfitf
    nlnsvrgshffyefgdgfgvtdswtkvdmksvlidpiplg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zzjC (C:)
    mdsstatamtapfidptdhvnlktdtdasenrrmgnykpsiwnydflqslathhniveer
    hlklaeklkgqvkfmfgapmeplaklelvdvvqrlglnhlfeteikealfsiykdgsngw
    wfghlhatslrfrllrqcglfipqdvfktfqnktgefdmklcdnvkgllslyeasylgwk
    genildeakafttkclksawenisekwlakrvkhalalplhwrvpriearwfieayeqea
    nmnptllklakldfnmvqsihqkeigelarwwvttgldklafarnnllqsymwscaiasd
    pkfklaretiveigsvltvvddgydvygsideldlytssverwscveidklpntlklifm
    smfnktnevglrvqhergynsiptfikawveqcksyqkearwfhgghtppleeyslnglv
    sigfplllitgyvaiaeneaaldkvhplpdllhyssllsrlindigtspdemargdnlks
    ihcymnetgaseevarehikgvieenwkilnqccfdqsqfqepfitfnlnsvrgshffye
    fgdgfgvtdswtkvdmksvlidpiplgee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zzjC (C:)
    psiwnydflqslathhniveerhlklaeklkgqvkfmfgapmeplaklelvdvvqrlgln
    hlfeteikealfsiykdgsngwwfghlhatslrfrllrqcglfipqdvfktfqnktgefd
    mklcdnvkgllslyeasylgwkgenildeakafttkclksawenisekwlakrvkhalal
    plhwrvpriearwfieayeqeanmnptllklakldfnmvqsihqkeigelarwwvttgld
    klafarnnllqsymwscaiasdpkfklaretiveigsvltvvddgydvygsideldlyts
    sverwscveidklpntlklifmsmfnktnevglrvqhergynsiptfikawveqcksyqk
    earwfhgghtppleeyslnglvsigfplllitgyvaiaeneaaldkvhplpdllhyssll
    srlindigtslksihcymnetgaseevarehikgvieenwkilnqccfdqsqfqepfitf
    nlnsvrgshffyefgdgfgvtdswtkvdmksvlidpipl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zzjD (D:)
    mdsstatamtapfidptdhvnlktdtdasenrrmgnykpsiwnydflqslathhniveer
    hlklaeklkgqvkfmfgapmeplaklelvdvvqrlglnhlfeteikealfsiykdgsngw
    wfghlhatslrfrllrqcglfipqdvfktfqnktgefdmklcdnvkgllslyeasylgwk
    genildeakafttkclksawenisekwlakrvkhalalplhwrvpriearwfieayeqea
    nmnptllklakldfnmvqsihqkeigelarwwvttgldklafarnnllqsymwscaiasd
    pkfklaretiveigsvltvvddgydvygsideldlytssverwscveidklpntlklifm
    smfnktnevglrvqhergynsiptfikawveqcksyqkearwfhgghtppleeyslnglv
    sigfplllitgyvaiaeneaaldkvhplpdllhyssllsrlindigtspdemargdnlks
    ihcymnetgaseevarehikgvieenwkilnqccfdqsqfqepfitfnlnsvrgshffye
    fgdgfgvtdswtkvdmksvlidpiplgee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zzjD (D:)
    psiwnydflqslathhniveerhlklaeklkgqvkfmfgapmeplaklelvdvvqrlgln
    hlfeteikealfsiykdgsngwwfghlhatslrfrllrqcglfipqdvfktfqnktgefd
    mklcdnvkgllslyeasylgwkgenildeakafttkclksawenisekwlakrvkhalal
    plhwrvpriearwfieayeqeanmnptllklakldfnmvqsihqkeigelarwwvttgld
    klafarnnllqsymwscaiasdpkfklaretiveigsvltvvddgydvygsideldlyts
    sverwscveidklpntlklifmsmfnktnevglrvqhergynsiptfikawveqcksyqk
    earwfhgghtppleeyslnglvsigfplllitgyvaiaeneaaldkvhplpdllhyssll
    srlindigtsdnlksihcymnetgaseevarehikgvieenwkilnqccfdqsqfqepfi
    tfnlnsvrgshffyefgdgfgvtdswtkvdmksvlidpipl