PDB entry 5zzf

View 5zzf on RCSB PDB site
Description: X-ray structure of F43Y/H64D sperm whale myoglobin
Class: oxygen storage
Keywords: myoglobin, OXYGEN STORAGE
Deposited on 2018-06-01, released 2018-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered mutation (42)
      • engineered mutation (63)
    Domains in SCOPe 2.08: d5zzfa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5zzfA (A:)
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekydrfkhlkteaemkased
lkkdgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg