PDB entry 5zz3

View 5zz3 on RCSB PDB site
Description: Crystal structure of intracellular B30.2 domain of BTN3A3
Class: signaling protein
Keywords: Butyrophilin, SIGNALING PROTEIN
Deposited on 2018-05-30, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Butyrophilin, subfamily 3, member A3 isoform b variant
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59F79 (33-End)
      • expression tag (30-32)
    Domains in SCOPe 2.07: d5zz3a1, d5zz3a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zz3A (A:)
    mgsshhhhhhssglvprgshmenlyfqgagagaayhewkmalfkpadvildpdtanaill
    vsedqrsvqraeeprdlpdnperfewrycvlgcenftsgrhywevevgdrkewhigvcsk
    nverkkgwvkmtpengywtmgltdgnkyralteprtnlklpepprkvgifldyetgeisf
    ynatdgshiytfphasfseplypvfriltleptalticpipkevesspdpdlvpdhslet
    pltpglanesgepqaevtslllpahpgaevspsattnqnhklqartealy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz3A (A:)
    agaayhewkmalfkpadvildpdtanaillvsedqrsvqraeeprdlpdnperfewrycv
    lgcenftsgrhywevevgdrkewhigvcsknverkkgwvkmtpengywtmgltdgnkyra
    lteprtnlklpepprkvgifldyetgeisfynatdgshiytfphasfseplypvfriltl
    eptalticpip