PDB entry 5zz0

View 5zz0 on RCSB PDB site
Description: human gelsolin from residues glu28 to arg161 with calcium
Class: metal binding protein
Keywords: actin binding protein, metal binding protein
Deposited on 2018-05-29, released 2019-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-05, with a file datestamp of 2019-05-30.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gelsolin
    Species: Homo sapiens [TaxId:9606]
    Gene: GSN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz0a_
  • Chain 'G':
    Compound: gelsolin
    Species: Homo sapiens [TaxId:9606]
    Gene: GSN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zz0g_
  • Heterogens: CA, PG0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zz0A (A:)
    ehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhy
    wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvas
    gfkhvvpnevvvqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz0A (A:)
    ehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhy
    wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvas
    gfk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5zz0G (G:)
    ehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhy
    wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvas
    gfkhvvpnevvvqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zz0G (G:)
    hpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhyw
    lgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvasg
    fk