PDB entry 5zxl

View 5zxl on RCSB PDB site
Description: Structure of GldA from E.coli
Class: oxidoreductase
Keywords: Dehydrogenase, Glycerol, Catalytic, OXIDOREDUCTASE
Deposited on 2018-05-21, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycerol dehydrogenase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: gldA, b3945, JW5556
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zxla_
  • Chain 'B':
    Compound: glycerol dehydrogenase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: gldA, b3945, JW5556
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zxlb_
  • Chain 'C':
    Compound: glycerol dehydrogenase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: gldA, b3945, JW5556
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zxlc_
  • Chain 'D':
    Compound: glycerol dehydrogenase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: gldA, b3945, JW5556
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zxld_
  • Heterogens: ZN, GOL, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zxlA (A:)
    mdriiqspgkyiqgadvinrlgeylkplaerwlvvgdkfvlgfaqstveksfkdaglvve
    iapfggecsqneidrlrgiaetaqcgailgigggktldtakalahfmgvpvaiaptiast
    dapcsalsviytdegefdrylllpnnpnmvivdtkivagaparllaagigdalatwfear
    acsrsgattmaggkctqaalalaelcyntlleegekamlaaeqhvvtpalervieantyl
    sgvgfesgglaaahavhngltaipdahhyyhgekvafgtltqlvlenapveeietvaals
    havglpitlaqldikedvpakmrivaeaacaegetihnmpggatpdqvyaallvadqygq
    rflqewe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zxlB (B:)
    mdriiqspgkyiqgadvinrlgeylkplaerwlvvgdkfvlgfaqstveksfkdaglvve
    iapfggecsqneidrlrgiaetaqcgailgigggktldtakalahfmgvpvaiaptiast
    dapcsalsviytdegefdrylllpnnpnmvivdtkivagaparllaagigdalatwfear
    acsrsgattmaggkctqaalalaelcyntlleegekamlaaeqhvvtpalervieantyl
    sgvgfesgglaaahavhngltaipdahhyyhgekvafgtltqlvlenapveeietvaals
    havglpitlaqldikedvpakmrivaeaacaegetihnmpggatpdqvyaallvadqygq
    rflqewe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zxlC (C:)
    mdriiqspgkyiqgadvinrlgeylkplaerwlvvgdkfvlgfaqstveksfkdaglvve
    iapfggecsqneidrlrgiaetaqcgailgigggktldtakalahfmgvpvaiaptiast
    dapcsalsviytdegefdrylllpnnpnmvivdtkivagaparllaagigdalatwfear
    acsrsgattmaggkctqaalalaelcyntlleegekamlaaeqhvvtpalervieantyl
    sgvgfesgglaaahavhngltaipdahhyyhgekvafgtltqlvlenapveeietvaals
    havglpitlaqldikedvpakmrivaeaacaegetihnmpggatpdqvyaallvadqygq
    rflqewe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zxlD (D:)
    mdriiqspgkyiqgadvinrlgeylkplaerwlvvgdkfvlgfaqstveksfkdaglvve
    iapfggecsqneidrlrgiaetaqcgailgigggktldtakalahfmgvpvaiaptiast
    dapcsalsviytdegefdrylllpnnpnmvivdtkivagaparllaagigdalatwfear
    acsrsgattmaggkctqaalalaelcyntlleegekamlaaeqhvvtpalervieantyl
    sgvgfesgglaaahavhngltaipdahhyyhgekvafgtltqlvlenapveeietvaals
    havglpitlaqldikedvpakmrivaeaacaegetihnmpggatpdqvyaallvadqygq
    rflqewe