PDB entry 5zxi

View 5zxi on RCSB PDB site
Description: Co-crystal structure of an Inhibitor in complex with human PPARdelta LBD
Class: transcription
Keywords: PPARdelta, Inhibitor compound Co-Crystal structure, TRANSCRIPTION
Deposited on 2018-05-21, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zxia_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zxib_
  • Heterogens: 9LU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zxiA (A:)
    gshmqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekgl
    vwkqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygv
    heaifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnaleldds
    dlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadl
    rqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zxiA (A:)
    qvadlkafskhiynaylknfnmtkkkarsiltgpfvihdietlwqaekglvwykeisvhv
    fyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgllv
    angsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpglm
    nvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqrikktet
    etslhpllqeiyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zxiB (B:)
    gshmqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekgl
    vwkqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygv
    heaifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnaleldds
    dlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadl
    rqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zxiB (B:)
    kafskhiynaylknfnmtkkkarsiltpfvihdietlwqaekykeisvhvfyrcqcttve
    tvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgllvangsgfvtre
    flrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpglmnvprveaiqd
    tilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqrikktetetslhpllqe
    iyk