PDB entry 5zxf

View 5zxf on RCSB PDB site
Description: The 1.25A Crystal structure of His6-tagged Mdm2 in complex with nutlin-3a
Class: cell cycle
Keywords: p53., CELL CYCLE
Deposited on 2018-05-19, released 2018-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zxfa_
  • Heterogens: NUT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5zxfA (A:)
qetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllg
dlfgvpsfsvkehrkiytmiyrnlvvv