PDB entry 5zxe

View 5zxe on RCSB PDB site
Description: Structure of a consensus sequence derived from the FGF family
Class: cell cycle
Keywords: FGF, basic form, CELL CYCLE
Deposited on 2018-05-19, released 2019-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Consensus sequence based basic form of fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZXE (0-129)
    Domains in SCOPe 2.07: d5zxea_
  • Heterogens: GOL, SO4, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zxeA (A:)
    mrlrrlycrtggfhlqilpdgrvdgtrednspyslleiravevgvvaikgvksgrylamn
    kkgrlygskhftdeckfkerllengyntyssakyrrgwyvalnkngrpkkgnrtrrtqka
    thflplpvsg