PDB entry 5zwy

View 5zwy on RCSB PDB site
Description: Ribokinase from Leishmania donovani
Class: transferase
Keywords: Nucleotide binding, ATP binding, Metal ion binding, Ribokinase activity, Carbohydrate metabolic process, cytoplasm, TRANSFERASE
Deposited on 2018-05-17, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribokinase
    Species: Leishmania donovani (strain BPK282A1) [TaxId:981087]
    Gene: LDBPK_270430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zwya_
  • Chain 'B':
    Compound: ribokinase
    Species: Leishmania donovani (strain BPK282A1) [TaxId:981087]
    Gene: LDBPK_270430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zwyb_
  • Heterogens: GOL, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zwyA (A:)
    mgsshhhhhhssglvprgshmhrarnvrshtgeyapdilvvgscfldyvgyvdhmpqvge
    tmhsvsfhkgfggkganqavaagrlgakvamvsmvgtdgdgsdyikelerngvdtaymfr
    tgksstglamilvdtkssnneivicpnatnhftpellraqtnnyerilhtglkylicqne
    iplpttldtikeahsrgvytvfnsapapkpaeveqikpflpyvslfcpneveatlitgvk
    vtdtesafsaikalqqlgvrdvvitlgaagfvlsengaepvhvtgkhvkavdttgagdcf
    vgsmvyfmsrgrnlleackranecaaisvtrkgtqlsyphpselpagvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zwyA (A:)
    rarnvrshtgeyapdilvvgscfldyvgyvdhmpqvgetmhsvsfhkgfggkganqavaa
    grlgakvamvsmvgtdgdgsdyikelerngvdtaymfrtgksstglamilvdtkssnnei
    vicpnatnhftpellraqtnnyerilhtglkylicqneiplpttldtikeahsrgvytvf
    nsapapkpaeveqikpflpyvslfcpneveatlitgvkvtdtesafsaikalqqlgvrdv
    vitlgaagfvlsengaepvhvtgttgagdcfvgsmvyfmsrgrnlleackranecaaisv
    trkgtql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zwyB (B:)
    mgsshhhhhhssglvprgshmhrarnvrshtgeyapdilvvgscfldyvgyvdhmpqvge
    tmhsvsfhkgfggkganqavaagrlgakvamvsmvgtdgdgsdyikelerngvdtaymfr
    tgksstglamilvdtkssnneivicpnatnhftpellraqtnnyerilhtglkylicqne
    iplpttldtikeahsrgvytvfnsapapkpaeveqikpflpyvslfcpneveatlitgvk
    vtdtesafsaikalqqlgvrdvvitlgaagfvlsengaepvhvtgkhvkavdttgagdcf
    vgsmvyfmsrgrnlleackranecaaisvtrkgtqlsyphpselpagvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zwyB (B:)
    rarnvrshtgeyapdilvvgscfldyvgyvdhmpqvgetmhsvsfhkgfggkganqavaa
    grlgakvamvsmvgtdgdgsdyikelerngvdtaymfrtgksstglamilvdtkssnnei
    vicpnatnhftpellraqtnnyerilhtglkylicqneiplpttldtikeahsrgvytvf
    nsapapkpaeveqikpflpyvslfcpneveatlitgvkdtesafsaikalqqlgvrdvvi
    tlgaagfvlsengaepvhvtgkhvkavdttgagdcfvgsmvyfmsrgrnlleackranec
    aaisvtrkgtqlsyphpselpagvm