PDB entry 5zwt

View 5zwt on RCSB PDB site
Description: Crystal structure of the S37A mutant of apo-acyl carrier protein from Leishmania major
Class: lipid binding protein
Keywords: Leishmania major; Acyl carrier protein; Fatty acid biosynthesis, LIPID BINDING PROTEIN
Deposited on 2018-05-16, released 2019-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: Leishmania major [TaxId:5664]
    Gene: ACP, LMJF_27_0290
    Database cross-references and differences (RAF-indexed):
    • Uniprot E9AD06 (5-82)
      • expression tag (0-4)
      • engineered mutation (39)
    Domains in SCOPe 2.08: d5zwta1, d5zwta2
  • Chain 'B':
    Compound: Acyl carrier protein
    Species: Leishmania major [TaxId:5664]
    Gene: ACP, LMJF_27_0290
    Database cross-references and differences (RAF-indexed):
    • Uniprot E9AD06 (5-82)
      • expression tag (0-4)
      • engineered mutation (39)
    Domains in SCOPe 2.08: d5zwtb1, d5zwtb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zwtA (A:)
    gshmndvltrvlevvknfekvdaskvtpeshfvkdlglnaldvvevvfaieqefildipd
    hdaekiqsipdaveyiaqnpmak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zwtB (B:)
    gshmndvltrvlevvknfekvdaskvtpeshfvkdlglnaldvvevvfaieqefildipd
    hdaekiqsipdaveyiaqnpmak