PDB entry 5zwp

View 5zwp on RCSB PDB site
Description: Crystal structure of the delta-class glutathione transferase from Musca domestica
Class: transferase
Keywords: isozyme, detoxification, housefly, GST, TRANSFERASE
Deposited on 2018-05-16, released 2018-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase 1
    Species: MUSCA DOMESTICA [TaxId:7370]
    Gene: Gst1, Gst-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28338 (0-End)
      • engineered mutation (172)
    Domains in SCOPe 2.08: d5zwpa1, d5zwpa2
  • Chain 'B':
    Compound: Glutathione S-transferase 1
    Species: MUSCA DOMESTICA [TaxId:7370]
    Gene: Gst1, Gst-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28338 (0-End)
      • engineered mutation (172)
    Domains in SCOPe 2.08: d5zwpb1, d5zwpb2
  • Heterogens: GSH, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zwpA (A:)
    mdfyylpgsapcrsvlmtakalgielnkkllnlqagehlkpeflkinpqhtiptlvdgdf
    alwesraimvylvekygktdslfpkcpkkravinqrlyfdmgtlyksfadyyypqifaka
    padpelfkkietafdflntflkgheyaagdsltvadlallasvstfevasfdiskypnva
    kwyanlktvapgweenwagclefkkyfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zwpA (A:)
    mdfyylpgsapcrsvlmtakalgielnkkllnlqagehlkpeflkinpqhtiptlvdgdf
    alwesraimvylvekygktdslfpkcpkkravinqrlyfdmgtlyksfadyyypqifaka
    padpelfkkietafdflntflkgheyaagdsltvadlallasvstfevasfdiskypnva
    kwyanlktvapgweenwagclefkkyf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zwpB (B:)
    mdfyylpgsapcrsvlmtakalgielnkkllnlqagehlkpeflkinpqhtiptlvdgdf
    alwesraimvylvekygktdslfpkcpkkravinqrlyfdmgtlyksfadyyypqifaka
    padpelfkkietafdflntflkgheyaagdsltvadlallasvstfevasfdiskypnva
    kwyanlktvapgweenwagclefkkyfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zwpB (B:)
    mdfyylpgsapcrsvlmtakalgielnkkllnlqagehlkpeflkinpqhtiptlvdgdf
    alwesraimvylvekygktdslfpkcpkkravinqrlyfdmgtlyksfadyyypqifaka
    padpelfkkietafdflntflkgheyaagdsltvadlallasvstfevasfdiskypnva
    kwyanlktvapgweenwagclefkkyf