PDB entry 5zwh

View 5zwh on RCSB PDB site
Description: Covalent bond formation between histidine of Vitamin D receptor (VDR) and a full agonist having an ene-ynone group via conjugate addition reaction
Class: hormone
Keywords: HORMONE covalent modifier transcription factor VitaminD3 enone Michael addition electrophile, HORMONE
Deposited on 2018-05-15, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Vdr, Nr1i1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zwha_
  • Chain 'C':
    Compound: 13-meric peptide from DRIP205 NR2 BOX peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZWH (0-End)
  • Heterogens: 9KX, 9N9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zwhA (A:)
    gshmgspnsplkdslrpklseeqqhiiailldahhktydptyadfrdfrppvrmdgstgs
    vtldlsplsmlphladlvsysiqkvigfakmipgfrdltsddqivllkssaievimlrsn
    qsftmddmswdcgsqdykydvtdvskaghtlelieplikfqvglkklnlheeehvllmai
    civspdrpgvqdaklveaiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslnee
    hskqyrslsfqpensmkltplvlevfgneis
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zwhA (A:)
    klseeqqhiiailldahhktydptyadfrdfrppvrlsmlphladlvsysiqkvigfakm
    ipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdykydvtdvskaghtl
    elieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklveaiqdrlsntlqtyi
    rcrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmkltplvlevfgn
    

  • Chain 'C':
    No sequence available.