PDB entry 5zw3

View 5zw3 on RCSB PDB site
Description: Crystal Structure of TrmR from B. subtilis
Class: RNA binding protein
Keywords: transferase, RNA BINDING PROTEIN
Deposited on 2018-05-14, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative O-methyltransferase YrrM
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: yrrM, BSU27360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zw3a_
  • Chain 'B':
    Compound: Putative O-methyltransferase YrrM
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: yrrM, BSU27360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zw3b_
  • Heterogens: SAH, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zw3A (A:)
    mtdryeqindyieallkprpdnvkrleayaeehhvpimekagmevllqilsvkqpkkile
    igtaigysairmalelpsaeiytiernekrheeavnnikefqlddrihvfygdalelada
    vhvtapydvifidaakgqyqnffhlyepmlspdgviitdnvlfkglvaedyskiepkrrr
    rlvakideynhwlmnhpdyqtaiipvgdglaiskkkrghhhhhhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zw3A (A:)
    tdryeqindyieallkprpdnvkrleayaeehhvpimekagmevllqilsvkqpkkilei
    gtaigysairmalelpsaeiytiernekrheeavnnikefqlddrihvfygdaleladav
    hvtapydvifidaakgqyqnffhlyepmlspdgviitdnvlfkglvaedyskvakideyn
    hwlmnhpdyqtaiipvgdglaiskkkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zw3B (B:)
    mtdryeqindyieallkprpdnvkrleayaeehhvpimekagmevllqilsvkqpkkile
    igtaigysairmalelpsaeiytiernekrheeavnnikefqlddrihvfygdalelada
    vhvtapydvifidaakgqyqnffhlyepmlspdgviitdnvlfkglvaedyskiepkrrr
    rlvakideynhwlmnhpdyqtaiipvgdglaiskkkrghhhhhhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zw3B (B:)
    dryeqindyieallkprpdnvkrleayaeehhvpimekagmevllqilsvkqpkkileig
    taigysairmalelpsaeiytiernekrheeavnnikefqlddrihvfygdaleladavh
    vtapydvifidaakgqyqnffhlyepmlspdgviitdnvlfideynhwlmnhpdyqtaii
    pvgdglaiskkkr