PDB entry 5zvq

View 5zvq on RCSB PDB site
Description: Crystal structure of recombination mediator protein RecR
Class: recombination
Keywords: recombination mediator protein, RECOMBINATION
Deposited on 2018-05-12, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: recombination protein recr
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Gene: recR, TTHA1600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zvqa_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zvqA (A:)
    mrypesllkltralsrlpgigpktaqrlalhlafhkeeaealaealegikrvracrecgn
    laegelcpicqdedrdrsllavvesvadlyalersgefrglyhvlggalnplegigpkel
    nleglfrrlegveevvlatsmtvegeatalylaeelkkrgvrvtrpayglpvggsleyad
    evtlgralegrrpv