PDB entry 5zvp

View 5zvp on RCSB PDB site
Description: Aspergillus fumigatus Rho1 F25N
Class: antibiotic
Keywords: Aspergillus fumigatus, Rho1 GTPase, cell wall target, ANTIBIOTIC
Deposited on 2018-05-12, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Rho GTPase Rho1
  Species: Aspergillus fumigatus Af293 [TaxId:330879]
  Gene: rho1, AFUA_6G06900
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A068C8U8 (0-180)
    • engineered mutation (24)
  Domains in SCOPe 2.07: d5zvpa_
• Heterogens: GDP, MG, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5zvpA (A:)
  maeirrklvivgdgacgktcllivnskgtfpevyvptvfenyvadvevdgkhvelalwdt
  agqedydrlrplsypdshvilicfaidspdsldnvqekwisevlhfcqglpiilvgckkd
  lrhdpktieelhktsqkpvtpeqgeevrkkigaykylecsartnegvrevfeaatraall
  t