PDB entry 5zvl

View 5zvl on RCSB PDB site
Description: Crystal Structure of Wheat Glutarredoxin
Class: oxidoreductase
Keywords: glutarredoxin, thioreducins, OXIDOREDUCTASE
Deposited on 2018-05-11, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin
    Species: TRITICUM AESTIVUM [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5A8A6 (50-End)
      • expression tag (47-49)
      • conflict (101)
      • conflict (133)
      • conflict (142)
    Domains in SCOPe 2.07: d5zvla1, d5zvla2
  • Chain 'B':
    Compound: glutaredoxin
    Species: TRITICUM AESTIVUM [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5A8A6 (50-End)
      • expression tag (43-49)
      • conflict (101)
      • conflict (133)
      • conflict (142)
    Domains in SCOPe 2.07: d5zvlb1, d5zvlb2
  • Chain 'C':
    Compound: glutaredoxin
    Species: TRITICUM AESTIVUM [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5A8A6 (50-End)
      • expression tag (46-49)
      • conflict (101)
      • conflict (133)
      • conflict (142)
    Domains in SCOPe 2.07: d5zvlc1, d5zvlc2
  • Chain 'D':
    Compound: glutaredoxin
    Species: TRITICUM AESTIVUM [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5A8A6 (50-End)
      • expression tag (46-49)
      • conflict (101)
      • conflict (133)
      • conflict (142)
    Domains in SCOPe 2.07: d5zvld1, d5zvld2
  • Chain 'E':
    Compound: glutaredoxin
    Species: TRITICUM AESTIVUM [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5A8A6 (50-End)
      • expression tag (48-49)
      • conflict (101)
      • conflict (133)
      • conflict (142)
    Domains in SCOPe 2.07: d5zvle1, d5zvle2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zvlA (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamaisdpmalakakeiv
    asapvvvfsksycpfcvqvkklftqlgasfkaieldtesdgteiqsalaewtgqrtvpnv
    fingkhiggcddtialnkggklvallteagaisgssskttvtplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zvlA (A:)
    sdpmalakakeivasapvvvfsksycpfcvqvkklftqlgasfkaieldtesdgteiqsa
    laewtgqrtvpnvfingkhiggcddtialnkggklvallteaga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zvlB (B:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamaisdpmalakakeiv
    asapvvvfsksycpfcvqvkklftqlgasfkaieldtesdgteiqsalaewtgqrtvpnv
    fingkhiggcddtialnkggklvallteagaisgssskttvtplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zvlB (B:)
    amaisdpmalakakeivasapvvvfsksycpfcvqvkklftqlgasfkaieldtesdgte
    iqsalaewtgqrtvpnvfingkhiggcddtialnkggklvallteaga
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zvlC (C:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamaisdpmalakakeiv
    asapvvvfsksycpfcvqvkklftqlgasfkaieldtesdgteiqsalaewtgqrtvpnv
    fingkhiggcddtialnkggklvallteagaisgssskttvtplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zvlC (C:)
    isdpmalakakeivasapvvvfsksycpfcvqvkklftqlgasfkaieldtesdgteiqs
    alaewtgqrtvpnvfingkhiggcddtialnkggklvallteagai
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zvlD (D:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamaisdpmalakakeiv
    asapvvvfsksycpfcvqvkklftqlgasfkaieldtesdgteiqsalaewtgqrtvpnv
    fingkhiggcddtialnkggklvallteagaisgssskttvtplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zvlD (D:)
    isdpmalakakeivasapvvvfsksycpfcvqvkklftqlgasfkaieldtesdgteiqs
    alaewtgqrtvpnvfingkhiggcddtialnkggklvallteagai
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5zvlE (E:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamaisdpmalakakeiv
    asapvvvfsksycpfcvqvkklftqlgasfkaieldtesdgteiqsalaewtgqrtvpnv
    fingkhiggcddtialnkggklvallteagaisgssskttvtplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zvlE (E:)
    dpmalakakeivasapvvvfsksycpfcvqvkklftqlgasfkaieldtesdgteiqsal
    aewtgqrtvpnvfingkhiggcddtialnkggklvallteaga