PDB entry 5zv6

View 5zv6 on RCSB PDB site
Description: Solution structure of peptide cQ2 from Chenopodium quinoa
Class: plant protein
Keywords: Hevein-like, cysteine-rich, chitin-binding, PLANT PROTEIN
Deposited on 2018-05-09, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cQ2
    Species: Chenopodium quinoa [TaxId:63459]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZV6 (0-29)
    Domains in SCOPe 2.07: d5zv6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zv6A (A:)
    agecvrgrcpgglccskfgfcgsgpaycgg