PDB entry 5zv2

View 5zv2 on RCSB PDB site
Description: FGFR-1 in complex with ligand lenvatinib
Class: transferase
Keywords: FGF RECEPTOR KINASE, TRANSFERASE-TRANSFERASE INHIBITOR complex, BIOSYNTHETIC PROTEIN, TRANSFERASE
Deposited on 2018-05-09, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered mutation (28)
    Domains in SCOPe 2.07: d5zv2a_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (1-304)
      • expression tag (0)
      • engineered mutation (28)
    Domains in SCOPe 2.07: d5zv2b1, d5zv2b2
  • Heterogens: LEV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zv2A (A:)
    sseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksd
    atekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpp
    gleycynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmki
    adfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggs
    pypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldriva
    ltsnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zv2A (A:)
    yelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdate
    kdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpeqls
    skdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardhidyykktt
    ngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghr
    mdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivalts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zv2B (B:)
    sseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksd
    atekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpp
    gleycynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmki
    adfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggs
    pypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldriva
    ltsnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zv2B (B:)
    sseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksd
    atekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpe
    eqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgldyykktrl
    pvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkp
    snctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnq