PDB entry 5zun

View 5zun on RCSB PDB site
Description: Crystal structure of human monoacylglycerol lipase in complex with compound 3l
Class: hydrolase/inhibitor
Keywords: MONOACYLGLYCEROL LIPASE, HYDROLASE-INHIBITOR complex
Deposited on 2018-05-08, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monoglyceride lipase
    Species: Homo sapiens [TaxId:9606]
    Gene: MGLL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99685
      • engineered mutation (37)
      • engineered mutation (170)
      • engineered mutation (177)
    Domains in SCOPe 2.07: d5zuna_
  • Heterogens: 9JX, PG4, EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zunA (A:)
    gsmpeessprrtpqsipyqdlphlvnadgqylfcrywaptgtpkalifvshgagehsgry
    eelarmlmgldllvfahdhvghgqsegermvvsdfhvfvrdvlqhvdsmqkdypglpvfl
    lghsmggaiailtaaerpghfagmvlisplvlanpesattfkvlaakvlnsvlpnlssgp
    idssvlsrnktevdiynsdplicraglkvcfgiqllnavsrveralpkltvpflllqgsa
    drlcdskgayllmelaksqdktlkiyegayhvlhkelpevtnsvfheinmwvsqrtatag
    taspp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zunA (A:)
    prrtpqsipyqdlphlvnadgqylfcrywaptgtpkalifvshgagehsgryeelarmlm
    gldllvfahdhvghgqsegermvvsdfhvfvrdvlqhvdsmqkdypglpvfllghsmgga
    iailtaaerpghfagmvlisplvlanpesattfkvlaakvlnsvlpnlssgpidssvlsr
    nktevdiynsdplicraglkvcfgiqllnavsrveralpkltvpflllqgsadrlcdskg
    ayllmelaksqdktlkiyegayhvlhkelpevtnsvfheinmwvsqrta