PDB entry 5zu0

View 5zu0 on RCSB PDB site
Description: Proteobacterial origin of protein arginine methylation and regulation of Complex I assembly by MidA
Class: transferase
Keywords: MidA, Mitochondrial Complex I, SAM, SAH, Protein Arginine Methyl Transferase, TRANSFERASE
Deposited on 2018-05-05, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein arginine methyltransferase NDUFAF7 homolog, mitochondrial
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Gene: midA, DDB_G0282615
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zu0a_
  • Chain 'B':
    Compound: Protein arginine methyltransferase NDUFAF7 homolog, mitochondrial
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Gene: midA, DDB_G0282615
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zu0b_
  • Chain 'C':
    Compound: Protein arginine methyltransferase NDUFAF7 homolog, mitochondrial
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Gene: midA, DDB_G0282615
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zu0c_
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zu0A (A:)
    gplgskqvfknrkypitdfekylqditkvrgpmsidtfikevltnpkygyymnkdvfgkg
    gdfitapevsqlfgemigiwcvatweamgkpkklqivemgpgrgtlmkdilrstkvfkef
    ydsisvhlveaspankktqkqnllyfkdkainfdhktigetpngikvtwvgkleevptdi
    ptlflaqeffdalpihvfrfsrekndwcevlvdeditehgeyylrfvqskgptlmttavk
    hllpefgldgyqvelglaglaisqqianridksggaaliidygydkivksslqairdhef
    vdildkpgtadlsvwvdfqtirktvkllknkstaigpvdqgiflkemgiehrlaqigrkl
    dsnekfeelvmgykklvdpkemgtnykviticdknitpigfstsktyddedlmi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zu0A (A:)
    kypitdfekylqditkvrgpmsidtfikevltnpkygyymnkdvfgkggdfitapevsql
    fgemigiwcvatweamgkpkklqivemgpgrgtlmkdilrstkvfkefydsisvhlveas
    pankktqkqnllyfkdkainfdhktigetpngikvtwvgkleevptdiptlflaqeffda
    lpihvfrfsrekndwcevlvdeditehgeyylrfvqskgptlmttavkhllpefgldgyq
    velglaglaisqqianridksggaaliidygydkivksslqairdhefvdildkpgtadl
    svwvdfqtirktvkllknkstaigpvdqgiflkemgiehrlaqigrkldsnekfeelvmg
    ykklvdpkemgtnykviticdknitpigfstsktyddedl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zu0B (B:)
    gplgskqvfknrkypitdfekylqditkvrgpmsidtfikevltnpkygyymnkdvfgkg
    gdfitapevsqlfgemigiwcvatweamgkpkklqivemgpgrgtlmkdilrstkvfkef
    ydsisvhlveaspankktqkqnllyfkdkainfdhktigetpngikvtwvgkleevptdi
    ptlflaqeffdalpihvfrfsrekndwcevlvdeditehgeyylrfvqskgptlmttavk
    hllpefgldgyqvelglaglaisqqianridksggaaliidygydkivksslqairdhef
    vdildkpgtadlsvwvdfqtirktvkllknkstaigpvdqgiflkemgiehrlaqigrkl
    dsnekfeelvmgykklvdpkemgtnykviticdknitpigfstsktyddedlmi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zu0B (B:)
    kypitdfekylqditkvrgpmsidtfikevltnpkygyymnkdvfgkggdfitapevsql
    fgemigiwcvatweamgkpkklqivemgpgrgtlmkdilrstkvfkefydsisvhlveas
    pankktqkqnllyfkdkainfdhktigetpngikvtwvgkleevptdiptlflaqeffda
    lpihvfrfsrekndwcevlvdeditehgeyylrfvqskgptlmttavkhllpefgldgyq
    velglaglaisqqianridksggaaliidygydkivksslqairdhefvdildkpgtadl
    svwvdfqtirktvkllknkstaigpvdqgiflkemgiehrlaqigrkldsnekfeelvmg
    ykklvdpkemgtnykviticdknitpigfstsktyddedl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zu0C (C:)
    gplgskqvfknrkypitdfekylqditkvrgpmsidtfikevltnpkygyymnkdvfgkg
    gdfitapevsqlfgemigiwcvatweamgkpkklqivemgpgrgtlmkdilrstkvfkef
    ydsisvhlveaspankktqkqnllyfkdkainfdhktigetpngikvtwvgkleevptdi
    ptlflaqeffdalpihvfrfsrekndwcevlvdeditehgeyylrfvqskgptlmttavk
    hllpefgldgyqvelglaglaisqqianridksggaaliidygydkivksslqairdhef
    vdildkpgtadlsvwvdfqtirktvkllknkstaigpvdqgiflkemgiehrlaqigrkl
    dsnekfeelvmgykklvdpkemgtnykviticdknitpigfstsktyddedlmi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zu0C (C:)
    kypitdfekylqditkvrgpmsidtfikevltnpkygyymnkdvfgkggdfitapevsql
    fgemigiwcvatweamgkpkklqivemgpgrgtlmkdilrstkvfkefydsisvhlveas
    pankktqkqnllyfkdkainfdhktigetpngikvtwvgkleevptdiptlflaqeffda
    lpihvfrfsrekndwcevlvdeditehgeyylrfvqskgptlmttavkhllpefgldgyq
    velglaglaisqqianridksggaaliidygydkivksslqairdhefvdildkpgtadl
    svwvdfqtirktvkllknkstaigpvdqgiflkemgiehrlaqigrkldsnekfeelvmg
    ykklvdpkemgtnykviticdknitpigfstsktyddedl