PDB entry 5zto

View 5zto on RCSB PDB site
Description: Crystal structure of EGFR 696-1022 T790M/C797S in complex with D3003
Class: transferase
Keywords: EGFR, T790M/C797S, inhibitor, TRANSFERASE
Deposited on 2018-05-04, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
      • engineered mutation (105)
    Domains in SCOPe 2.07: d5ztoa_
  • Heterogens: 9JO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ztoA (A:)
    gamggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgslldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ztoA (A:)
    eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelatspkanke
    ildeayvmasvdnphvcrllgicltstvqlimqlmpfgslldyvrehkdnigsqyllnwc
    vqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglapikwmalesilhriythqs
    dvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmida
    dsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfymddvvdadeyl