PDB entry 5ztl

View 5ztl on RCSB PDB site
Description: Non-cryogenic structure of light-driven chloride pump having an NTQ motif
Class: transport protein
Keywords: Chloride pump, Serial femtosecond crystallography, X-ray free electron laser, TRANSPORT PROTEIN
Deposited on 2018-05-04, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chloride pumping rhodopsin
    Species: Nonlabens marinus [TaxId:930802]
    Gene: ClR, NMS_1267
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ztla_
  • Heterogens: CL, RET, OLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ztlA (A:)
    pnsmknieslfdysagqfefidhlltmgvgvhfaalifflvvsqfvapkyriatalsciv
    mvsaglilnsqavmwtdayayvdgsyqlqdltfsngyryvnwmatipclllqllivlnlk
    gkelfstatwlilaawgmiitgyvgqlyevddiaqlmiwgavstaffvvmnwivgtkifk
    nratmlggtdstitkvfwlmmfawtlypiaylvpafmnnadgvvlrqllftiadisskvi
    yglmityiaiqqsaaagyvpaqqalgrigmdskaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ztlA (A:)
    knieslfdysagqfefidhlltmgvgvhfaalifflvvsqfvapkyriatalscivmvsa
    glilnsqavmwtdayayvdgsyqlqdltfsngyryvnwmatipclllqllivlnlkkelf
    statwlilaawgmiitgyvgqlyevddiaqlmiwgavstaffvvmnwivgtkifknratm
    lggtdstitkvfwlmmfawtlypiaylvpafmnnadgvvlrqllftiadisskviyglmi
    tyiaiqqsaaagyvpaqqal