PDB entry 5ztk

View 5ztk on RCSB PDB site
Description: Synchrotron structure of light-driven chloride pump having an NTQ motif
Class: signaling protein
Keywords: Chloride pump, SIGNALING PROTEIN
Deposited on 2018-05-04, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chloride pumping rhodopsin
    Species: Nonlabens marinus S1-08 [TaxId:1454201]
    Gene: ClR, NMS_1267
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ztka_
  • Heterogens: CL, RET, OLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ztkA (A:)
    pnsmknieslfdysagqfefidhlltmgvgvhfaalifflvvsqfvapkyriatalsciv
    mvsaglilnsqavmwtdayayvdgsyqlqdltfsngyryvnwmatipclllqllivlnlk
    gkelfstatwlilaawgmiitgyvgqlyevddiaqlmiwgavstaffvvmnwivgtkifk
    nratmlggtdstitkvfwlmmfawtlypiaylvpafmnnadgvvlrqllftiadisskvi
    yglmityiaiqqsaaagyvpaqqalgrigmdskaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ztkA (A:)
    knieslfdysagqfefidhlltmgvgvhfaalifflvvsqfvapkyriatalscivmvsa
    glilnsqavmwtdayayvdgsyqlqdltfsngyryvnwmatipclllqllivlnlkgkel
    fstatwlilaawgmiitgyvgqlyevddiaqlmiwgavstaffvvmnwivgtkifknrat
    mlggtdstitkvfwlmmfawtlypiaylvpafmnnadgvvlrqllftiadisskviyglm
    ityiaiqqsaaagyvpaqqalgri