PDB entry 5ztj

View 5ztj on RCSB PDB site
Description: Crystal Structure of GyraseA C-Terminal Domain from Salmonella typhi at 2.4A Resolution
Class: DNA binding protein
Keywords: Topoisomerase, DNA binding protein, Gyr-CTD, beta propeller
Deposited on 2018-05-03, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit A
    Species: Salmonella enterica subsp. enterica serovar Typhi [TaxId:90370]
    Gene: gyrA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ztja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ztjA (A:)
    mgedlisqedvvvtlshqgyvkyqpltdyeaqrrggkgksaarikeedfidrllvanthd
    tilcfssrgrlywmkvyqlpeasrgargrpivnllpleaneritailpvreyeegvnvfm
    atasgtvkktaltefsrprsagiiavnlndgdeligvdltsgsdevmlfsaagkvvrfke
    davramgrtatgvrgiklagddkvvsliiprgegailtvtqngygkrtaadeyptksrat
    qgvisikvterngsvvgavqvddcdqimmitdagtlvrtrvseisvvgrntqgvilirta
    edenvvglqrva
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ztjA (A:)
    qedvvvtlshqgyvkyqpltdyeaqedfidrllvanthdtilcfssrgrlywmkvyqlpe
    asrgargrpivnllpleaneritailpvreyeegvnvfmatasgtvkktaltefsrprsa
    giiavnlndgdeligvdltsgsdevmlfsaagkvvrfkedavramgrtatgvrgiklagd
    dkvvsliiprgegailtvtqngygkrtaadeyptksratqgvisikvterngsvvgavqv
    ddcdqimmitdagtlvrtrvseisvvgrntqgvilirtaedenvvglqrv