PDB entry 5zsz

View 5zsz on RCSB PDB site
Description: Catechol 2,3-dioxygenase (C23O64) from Diaphorobacter sp DS2
Class: oxidoreductase
Keywords: Apo crystal of catechol 2, 3 dioxygenase, OXIDOREDUCTASE
Deposited on 2018-04-30, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol 2,3-dioxygenase, Extradiol ring cleavage protein
    Species: Diaphorobacter sp. DS2 [TaxId:1302548]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZSZ (0-292)
    Domains in SCOPe 2.07: d5zsza1, d5zsza2
  • Heterogens: CA, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zszA (A:)
    mgvlrighaslkvmdmdaavrhyenvlgmkttmkdkagnvylkcwdewdkysviltpsdq
    agmnhlaykvekeadlealqqkieawgvkttmldegtlpstgrmlqfklpsghemrlyas
    kefvgtdvgninpdpwpdglkgagahwldhcllvcemnpeagintvadntrfvtecldff
    lteqvlvgpggsiqattflartttphdiafvggptsglhhiaffldswhdvlkaadvmak
    nkvridvaptrhgitrgetiyffdpsgnrnetfaglgylaqrdrpvttwtedq