PDB entry 5zsx

View 5zsx on RCSB PDB site
Description: Catechol 2,3-dioxygenase with 3-fluorocatechol from Diaphorobacter sp DS2
Class: oxidoreductase
Keywords: Crystal of catechol 2, 3 dioxygenase soaked in 3-fluorocatechol, OXIDOREDUCTASE
Deposited on 2018-04-30, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol 2,3-dioxygenase, extradiol protein
    Species: Diaphorobacter sp. DS2 [TaxId:1302548]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZSX (0-313)
    Domains in SCOPe 2.07: d5zsxa1, d5zsxa2
  • Heterogens: CA, FE, 3FA, PEG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zsxA (A:)
    mgvlrighaslkvmdmdaavrhyenvlgmkttmkdkagnvylkcwdewdkysviltpsdq
    agmnhlaykvekeadlealqqkieawgvkttmldegtlpstgrmlqfklpsghemrlyas
    kefvgtdvgninpdpwpdglkgagahwldhcllvcemnpeagintvadntrfvtecldff
    lteqvlvgpggsiqattflartttphdiafvggptsglhhiaffldswhdvlkaadvmak
    nkvridvaptrhgitrgetiyffdpsgnrnetfaglgylaqrdrpvttwtedqlgsaify
    htgylepsftdvyt