PDB entry 5zsr

View 5zsr on RCSB PDB site
Description: NifS from Hydrogenimonas thermophila, soaked with L-cysteine for 8 min
Class: biosynthetic protein
Keywords: Cysteine desulfurase, BIOSYNTHETIC PROTEIN
Deposited on 2018-04-29, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine desulfurase
    Species: Hydrogenimonas thermophila [TaxId:223786]
    Gene: SAMN05216234_11013
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zsra1, d5zsra2
  • Chain 'B':
    Compound: Cysteine desulfurase
    Species: Hydrogenimonas thermophila [TaxId:223786]
    Gene: SAMN05216234_11013
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zsrb1, d5zsrb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zsrA (A:)
    mahmkvyldnnattivdpevkaamdpyftqiygnpnslhdfgtechpalrkamdqmyeai
    gardeddivvtscatesnnwvlkgvyfdlikngdkdhiittevehpsvtatcrwleeqgv
    rvtylpvnqdgvveahtvrdfitdktalvsimwannetgaifpveeiseickekgvlfht
    dgvqaigkipvdviragvdfmsfsahkfhgpkgvgglyirnghpltsllhggehmggrrs
    gtlnvpgivgmgkamelatyylkfeeehvrklrdkledaileipdtysvgprenrtpnti
    lvsvrgvegeamlwdlnragiaastgsacasedleanpimvavgadselahtavrlslsr
    ftteeeidytieqfkkaverlrsisssyaympdnmkdkqlevdlvprgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zsrA (A:)
    ahmkvyldnnattivdpevkaamdpyftqiygnpnslhdfgtechpalrkamdqmyeaig
    ardeddivvtscatesnnwvlkgvyfdlikngdkdhiittevehpsvtatcrwleeqgvr
    vtylpvnqdgvveahtvrdfitdktalvsimwannetgaifpveeiseickekgvlfhtd
    gvqaigkipvdviragvdfmsfsahkfhgpkgvgglyirnghpltsllhggehmggrrsg
    tlnvpgivgmgkamelatyylkfeeehvrklrdkledaileipdtysvgprenrtpntil
    vsvrgvegeamlwdlnragiaastgsacasedleanpimvavgadselahtavrlslsrf
    tteeeidytieqfkkaverlrsisssya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zsrB (B:)
    mahmkvyldnnattivdpevkaamdpyftqiygnpnslhdfgtechpalrkamdqmyeai
    gardeddivvtscatesnnwvlkgvyfdlikngdkdhiittevehpsvtatcrwleeqgv
    rvtylpvnqdgvveahtvrdfitdktalvsimwannetgaifpveeiseickekgvlfht
    dgvqaigkipvdviragvdfmsfsahkfhgpkgvgglyirnghpltsllhggehmggrrs
    gtlnvpgivgmgkamelatyylkfeeehvrklrdkledaileipdtysvgprenrtpnti
    lvsvrgvegeamlwdlnragiaastgsacasedleanpimvavgadselahtavrlslsr
    ftteeeidytieqfkkaverlrsisssyaympdnmkdkqlevdlvprgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zsrB (B:)
    hmkvyldnnattivdpevkaamdpyftqiygnpnslhdfgtechpalrkamdqmyeaiga
    rdeddivvtscatesnnwvlkgvyfdlikngdkdhiittevehpsvtatcrwleeqgvrv
    tylpvnqdgvveahtvrdfitdktalvsimwannetgaifpveeiseickekgvlfhtdg
    vqaigkipvdviragvdfmsfsahkfhgpkgvgglyirnghpltsllhggehmggrrsgt
    lnvpgivgmgkamelatyylkfeeehvrklrdkledaileipdtysvgprenrtpntilv
    svrgvegeamlwdlnragiaastgsacasedleanpimvavgadselahtavrlslsrft
    teeeidytieqfkkaverlrsisssy