PDB entry 5zso

View 5zso on RCSB PDB site
Description: SufS from Bacillus subtilis, soaked with L-cysteine for 90 sec
Class: biosynthetic protein
Keywords: Cysteine desulfurase, BIOSYNTHETIC PROTEIN
Deposited on 2018-04-29, released 2019-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-01, with a file datestamp of 2020-03-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine desulfurase SufS
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: sufS, csd, yurW, BSU32690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zsoa_
  • Heterogens: PEG, C6P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zsoA (A:)
    mghmnitdireqfpilhqqvnghdlvyldsaatsqkpravietldkyynqynsnvhrgvh
    tlgtratdgyegarekvrkfinaksmaeiiftkgtttslnmvalsyaranlkpgdevvit
    ymehhaniipwqqavkatgatlkyiplqedgtisledvretvtsntkivavshvsnvlgt
    vnpikemakiahdngavivvdgaqstphmkidvqdldcdffalsshkmcgptgvgvlygk
    kallenmepaefggemidfvglyestwkelpwkfeagtpiiagaiglgaaidfleeigld
    eisrhehklaayalerfrqldgvtvygpeeraglvtfnlddvhphdvatvldaegiavra
    ghhcaqplmkwldvtatarasfylynteeeidklvealqktkeyftnvfvdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zsoA (A:)
    mnitdireqfpilhqqvnghdlvyldsaatsqkpravietldkyynqynsnvhrgvhtlg
    tratdgyegarekvrkfinaksmaeiiftkgtttslnmvalsyaranlkpgdevvityme
    hhaniipwqqavkatgatlkyiplqedgtisledvretvtsntkivavshvsnvlgtvnp
    ikemakiahdngavivvdgaqstphmkidvqdldcdffalsshkmcgptgvgvlygkkal
    lenmepaefggemidfvglyestwkelpwkfeagtpiiagaiglgaaidfleeigldeis
    rhehklaayalerfrqldgvtvygpeeraglvtfnlddvhphdvatvldaegiavraghh
    caqplmkwldvtatarasfylynteeeidklvealqktkeyftnv