PDB entry 5zs6

View 5zs6 on RCSB PDB site
Description: Dodecameric structure of a small Heat Shock Protein from Mycobacterium marinum M: Form-2
Class: chaperone
Keywords: sHSP, oligomers, polydispersity, CHAPERONE
Deposited on 2018-04-28, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molecular chaperone (Small heat shock protein)
    Species: Mycobacterium marinum M [TaxId:216594]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zs6a_
  • Chain 'U':
    Compound: gly-arg-leu-leu
    Species: Mycobacterium marinum M [TaxId:216594]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZS6 (0-3)
  • Heterogens: PEG, PRO, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zs6A (A:)
    mlmrtdpfrdldrfaqqvlgtsarpavmpmdawregdkfvvefdlpgidadsldidiern
    vvtvraerpavdpnremlaserprgvfsrqlvlgenldtariaasytegvlklqipvaek
    akprkisitrgagdktisengahpeviea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zs6A (A:)
    lgtsarpavmpmdawregdkfvvefdlpgidadsldidiernvvtvraerpavdpnreml
    aserprgvfsrqlvlgenldtariaasytegvlklqipvaekakprkisitr
    

  • Chain 'U':
    No sequence available.