PDB entry 5zrz

View 5zrz on RCSB PDB site
Description: Crystal Structure of EphA5/SAMD5 Complex
Class: protein binding
Keywords: sam domain, heterodimer, signaling protein, cell signaling, receptor, transmembrane, tyrosine-protein kinase, cell adhesion, protein binding
Deposited on 2018-04-25, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 5
    Species: Mus musculus [TaxId:10090]
    Gene: Epha5, Bsk, Ehk1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zrza_
  • Chain 'B':
    Compound: Sterile alpha motif domain-containing protein 5
    Species: Mus musculus [TaxId:10090]
    Gene: Samd5, E130306M17Rik, mCG_52174
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zrzb1, d5zrzb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zrzA (A:)
    gpgslgsgayrsvgewleaikmgryteifmengyssmdavaqvtledlrrlgvtlvghqk
    kimsslqemkvqmvngmvpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zrzA (A:)
    gayrsvgewleaikmgryteifmengyssmdavaqvtledlrrlgvtlvghqkkimsslq
    emkvqmvng
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zrzB (B:)
    gpgsmctnivyewlkalqlpqyaesfvdngyddlevckqigdpdldaigvlapahrrril
    eavhrlreqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zrzB (B:)
    mctnivyewlkalqlpqyaesfvdngyddlevckqigdpdldaigvlapahrrrileavh
    rlre