PDB entry 5zrx

View 5zrx on RCSB PDB site
Description: Crystal Structure of EphA2/SHIP2 Complex
Class: protein binding
Keywords: sam domain, heterodimer, signaling protein, cell signaling, receptor, transmembrane, tyrosine-protein kinase, cell adhesion, protein binding
Deposited on 2018-04-25, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2,Ephrin type-A receptor 2
    Species: Mus musculus [TaxId:10090]
    Gene: Epha2, Eck, Myk2, Sek2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6P549 (6-End)
      • expression tag (2-5)
    • Uniprot Q03145
    Domains in SCOPe 2.07: d5zrxa1, d5zrxa2, d5zrxa3
  • Chain 'B':
    Compound: Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2,Ephrin type-A receptor 2
    Species: Mus musculus [TaxId:10090]
    Gene: Epha2, Eck, Myk2, Sek2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zrxb1, d5zrxb2, d5zrxb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zrxA (A:)
    gpgsefmgawlraigleryeeglvhngwddleflsditeedleeagvqdpahkrllldtl
    qlskssgenlyfqssgssggssgsegvpfrtvsewlesikmqqytehfmvagytaiekvv
    qmsnedikrigvrlpghqkriaysllglkdqvntvgipi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zrxA (A:)
    gsefmgawlraigleryeeglvhngwddleflsditeedleeagvqdpahkrllldtlql
    spfrtvsewlesikmqqytehfmvagytaiekvvqmsnedikrigvrlpghqkriaysll
    glkdqv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zrxB (B:)
    gpgsefmgawlraigleryeeglvhngwddleflsditeedleeagvqdpahkrllldtl
    qlskssgenlyfqssgssggssgsegvpfrtvsewlesikmqqytehfmvagytaiekvv
    qmsnedikrigvrlpghqkriaysllglkdqvntvgipi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zrxB (B:)
    gsefmgawlraigleryeeglvhngwddleflsditeedleeagvqdpahkrllldtlql
    skfrtvsewlesikmqqytehfmvagytaiekvvqmsnedikrigvrlpghqkriaysll
    glkdq