PDB entry 5zrt

View 5zrt on RCSB PDB site
Description: Crystal structure of human C1ORF123 protein
Class: unknown function
Keywords: human hypothetical protein, UNKNOWN FUNCTION
Deposited on 2018-04-25, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0587 protein C1orf123
    Species: Homo sapiens [TaxId:9606]
    Gene: C1orf123
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zrta_
  • Chain 'B':
    Compound: UPF0587 protein C1orf123
    Species: Homo sapiens [TaxId:9606]
    Gene: C1orf123
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zrtb_
  • Heterogens: GOL, CL, ZN, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zrtA (A:)
    mgsshhhhhhssglvprgshmgkialqlkatlenitnlrpvgedfrwylkmkcgncgeis
    dkwqyirlmdsvalkggrgsasmvqkcklcarensieilsstikpynaednenfktivef
    ecrglepvdfqpqagfaaegvesgtafsdinlqekdwtdydekaqesvgiyevthqfvkc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zrtA (A:)
    mgkialqlkatlenitnlrpvgedfrwylkmkcgncgeisdkwqyirlmdsvalkggrgs
    asmvqkcklcarensieilsstikpynaednenfktivefecrglepvdfqpqagfaaeg
    vesgtafsdinlqekdwtdydekaqesvgiyevthqfvkc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zrtB (B:)
    mgsshhhhhhssglvprgshmgkialqlkatlenitnlrpvgedfrwylkmkcgncgeis
    dkwqyirlmdsvalkggrgsasmvqkcklcarensieilsstikpynaednenfktivef
    ecrglepvdfqpqagfaaegvesgtafsdinlqekdwtdydekaqesvgiyevthqfvkc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zrtB (B:)
    mgkialqlkatlenitnlrpvgedfrwylkmkcgncgeisdkwqyirlmdsvalkggrgs
    asmvqkcklcarensieilsstikpynaednenfktivefecrglepvdfqpqagfaaeg
    vesgtafsdinlqekdwtdydekaqesvgiyevthqfvkc