PDB entry 5zri

View 5zri on RCSB PDB site
Description: M. smegmatis antimutator protein MutT2 in complex with 5m-dCMP
Class: hydrolase
Keywords: Nudix hydrolase, MutT, antimutator, CTP pyrophosphorylase, CMP, HYDROLASE, base excision repair
Deposited on 2018-04-24, released 2019-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative mutator protein MutT2/NUDIX hydrolase
    Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
    Gene: mutT2, MSMEI_5016
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zria_
  • Heterogens: 9L3, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zriA (A:)
    mgsshhhhhhssglvprgshmtkqivvagalisrgtllvaqrdrpaelaglwelpggkvt
    pgesdadalarelreelgvdvavgerlgadvalndamtlrayrvtlrsgsphphdhralr
    wvgadeidglawvpadrawvpdlvaalsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zriA (A:)
    kqivvagalisrgtllvaqrdrpaelaglwelpggkvtpgesdadalarelreelgvdva
    vgerlgadvalndamtlrayrvtlrsgsphphdhralrwvgadeidglawvpadrawvpd
    lvaals