PDB entry 5zr8

View 5zr8 on RCSB PDB site
Description: Crystal Structure Of NDM-1 Metallo-beta-lactamase
Class: hydrolase
Keywords: hydrolase
Deposited on 2018-04-23, released 2019-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-1, bla NDM-1, AM434_27040, APU18_05360, AZ95_0035, BET08_16280, BVL39_26630, CA268_28970, ECS01_0033, MS6198_A142, NDM1Dok01_N0175, pNDM102337_147, pNDM10505_149
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zr8a_
  • Chain 'E':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-1, bla NDM-1, AM434_27040, APU18_05360, AZ95_0035, BET08_16280, BVL39_26630, CA268_28970, ECS01_0033, MS6198_A142, NDM1Dok01_N0175, pNDM102337_147, pNDM10505_149
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zr8e_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zr8A (A:)
    gshmgeirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdgg
    rvlvvdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanal
    snqlapqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdia
    fggclikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtar
    madklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zr8A (A:)
    gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqi
    lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsl
    tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
    gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5zr8E (E:)
    gshmgeirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdgg
    rvlvvdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanal
    snqlapqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdia
    fggclikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtar
    madklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zr8E (E:)
    etgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqta
    qilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqh
    sltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslg
    nlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr