PDB entry 5zr3

View 5zr3 on RCSB PDB site
Description: Crystal structure of Hsp90-alpha N-terminal domain in complex with 4-(3-isopropyl-4-(4-(1-methyl-1H-pyrazol-4-yl)-1H-imidazol-1-yl)-1H-pyrazolo[3,4-b]pyridin-1-yl)-3-methylbenzamide
Class: chaperone
Keywords: Inhibitor, Complex, CHAPERONE
Deposited on 2018-04-23, released 2019-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zr3a_
  • Chain 'C':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zr3c_
  • Chain 'E':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zr3e_
  • Chain 'G':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zr3g_
  • Heterogens: 9J0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zr3A (A:)
    hmpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldki
    ryesltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafm
    ealqagadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgep
    mgrgtkvilhlkedqteyleerrikeivkkhsqfigypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zr3A (A:)
    meeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskld
    sgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismi
    gqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlk
    edqteyleerrikeivkkhsqfigypitlfve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zr3C (C:)
    hmpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldki
    ryesltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafm
    ealqagadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgep
    mgrgtkvilhlkedqteyleerrikeivkkhsqfigypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zr3C (C:)
    meeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskld
    sgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismi
    gqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlk
    edqteyleerrikeivkkhsqfigypitlfvekerd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5zr3E (E:)
    hmpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldki
    ryesltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafm
    ealqagadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgep
    mgrgtkvilhlkedqteyleerrikeivkkhsqfigypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zr3E (E:)
    evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
    lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
    vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
    eyleerrikeivkkhsqfigypitlfve
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5zr3G (G:)
    hmpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldki
    ryesltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafm
    ealqagadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgep
    mgrgtkvilhlkedqteyleerrikeivkkhsqfigypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zr3G (G:)
    meeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskld
    sgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismi
    gqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlk
    edqteyleerrikeivkkhsqfigypitlfve